PDB entry 2bf8

View 2bf8 on RCSB PDB site
Description: crystal structure of sumo modified ubiquitin conjugating enzyme e2-25k
Class: ligase
Keywords: ligase-complex, e2-25k, e2 ubiquitin conjugating enzyme, sumo, sumo-target structure, ligase, structural proteomics in europe, spine, structural genomics
Deposited on 2004-12-06, released 2005-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2-25 kDa
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BF8
    • Uniprot P61085 (5-158)
    Domains in SCOPe 2.01: d2bf8a_
  • Chain 'B':
    Compound: Ubiquitin-like protein SMT3C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bf8b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bf8A (A:)
    gamamaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggry
    qleikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqal
    laaaepddpqdavvanqykqnpemfkqtarlwahvyaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf8A (A:)
    aniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleik
    ipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaae
    pddpqdavvanqykqnpemfkqtarlwahvyaga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bf8B (B:)
    yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
    gmeeedvievyqeqtgg