PDB entry 2bf7

View 2bf7 on RCSB PDB site
Description: leishmania major pteridine reductase 1 in complex with nadp and biopterin
Class: oxidoreductase
Keywords: pteridine reductase, trypanosomatids, drug resistance, pterin, salvage, short-chain dehydrogenase/reductase, methotrexate resistance, nadp, oxidoreductase
Deposited on 2004-12-06, released 2005-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bf7a_
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bf7b_
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bf7c_
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bf7d_
  • Heterogens: NAP, HBI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bf7A (A:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf7A (A:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllgdreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvif
    lcsskakyitgtcvkvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bf7B (B:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf7B (B:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvif
    lcsskakyitgtcvkvdggysltra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bf7C (C:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf7C (C:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptplleametatadlfgs
    naiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegltr
    saalelaplqirvngvgpglsvlvghrskvplyqrdssaaevsdvviflcsskakyitgt
    cvkvdggysltra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bf7D (D:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf7D (D:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatappvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatadlf
    gsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegl
    trsaalelaplqirvngvgpglsvlvrskvplyqrdssaaevsdvviflcsskakyitgt
    cvkvdggysltra