PDB entry 2bf5

View 2bf5 on RCSB PDB site
Description: Crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing four N-terminal residues (delta-N4 T4moD)
Class: oxidoreductase
Keywords: catalytic effector protein, n-terminal truncated mutant, aromatic hydrocarbon catabolism, oxidoreductase, monooxygenase, toluene oxidation, molecular replacement
Deposited on 2004-12-03, released 2005-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toluene-4-monooxygenase system protein d
    Species: PSEUDOMONAS MENDOCINA [TaxId:300]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bf5a_
  • Chain 'B':
    Compound: toluene-4-monooxygenase system protein d
    Species: PSEUDOMONAS MENDOCINA [TaxId:300]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bf5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bf5A (A:)
    dqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktle
    eqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf5A (A:)
    nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
    fnmqeleinlasfagqiqadedqirfyfdktm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bf5B (B:)
    dqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktle
    eqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf5B (B:)
    nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
    fnmqeleinlasfagqiqadedqirfyfdktm