PDB entry 2bf3

View 2bf3 on RCSB PDB site
Description: crystal structure of a toluene 4-monooxygenase catalytic effector protein variant missing ten n-terminal residues (delta-n10 t4mod)
Class: oxidoreductase
Keywords: catalytic effector protein, n-terminal truncated mutant, toluene oxidation, aromatic hydrocarbon catabolism, molecular replacement, monooxygenase, oxidoreductase
Deposited on 2004-12-03, released 2005-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toluene-4-monooxygenase system protein d
    Species: PSEUDOMONAS MENDOCINA [TaxId:300]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00459 (0-End)
      • conflict (8-11)
    Domains in SCOPe 2.08: d2bf3a_
  • Chain 'B':
    Compound: toluene-4-monooxygenase system protein d
    Species: PSEUDOMONAS MENDOCINA [TaxId:300]
    Domains in SCOPe 2.08: d2bf3b_
  • Heterogens: HTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2bf3A (A:)
nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyfdktm

    Sequence, based on observed residues (ATOM records): (download) 
    >2bf3A (A:)
nnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyf

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2bf3B (B:)
nnvgpiirgdlvvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyfdktm

    Sequence, based on observed residues (ATOM records): (download) 
    >2bf3B (B:)
nnvgpiirgdlvvepvietaeidnpgkeitvedrrayvriaaegeliltrktleeqlgrp
fnmqeleinlasfagqiqadedqirfyf