PDB entry 2bf2

View 2bf2 on RCSB PDB site
Description: crystal structure of native toluene-4-monooxygenase catalytic effector protein, t4mod
Class: oxidoreductase
Keywords: catalytic effector protein, mad phasing, aromatic hydrocarbon catabolism, oxidoreductase, monooxygenase, toluene oxidation, fad, flavoprotein, iron
Deposited on 2004-12-03, released 2005-05-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.24809
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toluene-4-monooxygenase system protein d
    Species: Pseudomonas mendocina
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bf2a1
  • Chain 'B':
    Compound: toluene-4-monooxygenase system protein d
    Species: Pseudomonas mendocina
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bf2b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bf2A (A:)
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2bf2B (B:)
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

    Sequence, based on observed residues (ATOM records): (download) 
    >2bf2B (B:)
adqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltrktl
eeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm