PDB entry 2bf0

View 2bf0 on RCSB PDB site
Description: crystal structure of the rpr of pcf11
Class: transcription
Keywords: transcription, RNA, phosphorylation
Deposited on 2004-12-02, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.26
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: pcf11
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BF0
    • Uniprot P39081 (Start-142)
    Domains in SCOPe 2.07: d2bf0x_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2bf0X (X:)
    gplgsmdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekc
    mpkqklyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnp
    ndtglplfegsalekieqflika
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bf0X (X:)
    ivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqklyafyal
    dsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglplfegsa
    lekieqflika