PDB entry 2bez

View 2bez on RCSB PDB site
Description: structure of a proteolitically resistant core from the severe acute respiratory syndrome coronavirus s2 fusion protein
Class: Viral protein
Keywords: coiled coil,membrane fusion,severe acute respiratory syndrome,viral protein
Deposited on 2004-12-02, released 2004-12-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2082
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: e2 glycoprotein
    Species: Human SARS coronavirus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bez.1
  • Chain 'F':
    Compound: e2 glycoprotein
    Species: Human SARS coronavirus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bez.1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bezC (C:)
    nvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssnfgai
    ssvlndilsrldkveae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bezF (F:)
    tspdvdlgdisginasvvniqkeidrlnevaknlneslidlq