PDB entry 2bez

View 2bez on RCSB PDB site
Description: Structure of a proteolitically resistant core from the severe acute respiratory syndrome coronavirus S2 fusion protein
Class: viral protein
Keywords: coiled coil, membrane fusion, severe acute respiratory syndrome, viral protein
Deposited on 2004-12-02, released 2004-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-15, with a file datestamp of 2020-04-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: Spike glycoprotein
  Species: Human SARS coronavirus [TaxId:694009]
  Gene: S, 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59594 (0-76)
  Domains in SCOPe 2.08: d2bez.1
• Chain 'F':
  Compound: Spike glycoprotein
  Species: Human SARS coronavirus [TaxId:694009]
  Gene: S, 2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59594 (0-41)
  Domains in SCOPe 2.08: d2bez.1
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bezC (C:)
  nvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssnfgai
  ssvlndilsrldkveae
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bezF (F:)
  tspdvdlgdisginasvvniqkeidrlnevaknlneslidlq