PDB entry 2beo

View 2beo on RCSB PDB site
Description: prfa, transcriptional regulator in listeria monocytogenes
Class: transcription
Keywords: transcription, bacterial infection, human pathogen, transcriptional regulator, activator, virulence
Deposited on 2004-11-26, released 2005-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: listeriolysin regulatory protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2beoa1, d2beoa2
  • Chain 'B':
    Compound: listeriolysin regulatory protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2beob1, d2beob2
  • Heterogens: GLN, CL, PG4, ACM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2beoA (A:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2beoA (A:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelavsriis
    klkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2beoB (B:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2beoB (B:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgysssav
    sriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln