PDB entry 2ben

View 2ben on RCSB PDB site
Description: crystal structure of the serratia marcescens chitin-binding protein cbp21 y54a mutant.
Class: chitin-binding protein
Keywords: chitin-binding protein, chitin degradation, chitin-binding, fniii-like fold
Deposited on 2004-11-26, released 2004-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cbp21
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O83009 (0-169)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d2bena_
  • Chain 'B':
    Compound: cbp21
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O83009 (0-169)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d2benb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2benA (A:)
    hgyvespasrayqcklqlntqcgsvqaepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2benB (B:)
    hgyvespasrayqcklqlntqcgsvqaepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk