PDB entry 2ben

View 2ben on RCSB PDB site
Description: crystal structure of the serratia marcescens chitin-binding protein cbp21 y54a mutant.
Deposited on 2004-11-26, released 2004-12-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-08, with a file datestamp of 2004-12-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2bena_
  • Chain 'B':
    Domains in SCOP 1.71: d2benb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2benA (A:)
    hgyvespasrayqcklqlntqcgsvqaepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2benB (B:)
    hgyvespasrayqcklqlntqcgsvqaepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk