PDB entry 2bem

View 2bem on RCSB PDB site
Description: crystal structure of the serratia marcescens chitin-binding protein cbp21
Class: chitin-binding protein
Keywords: chitin-binding protein, chitin degradation, chitin-binding, fniii-like fold
Deposited on 2004-11-26, released 2004-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.156
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cbp21
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bema_
  • Chain 'B':
    Compound: cbp21
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bemb_
  • Chain 'C':
    Compound: cbp21
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bemc_
  • Heterogens: EDO, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bemA (A:)
    hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bemB (B:)
    hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bemC (C:)
    hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk