PDB entry 2bel

View 2bel on RCSB PDB site
Description: structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone
Class: oxidoreductase
Keywords: oxidoreductase, glucocorticoid activation, drug target, inhibitor, short-chain dehydrogenase/reductase, hormone metabolism, microsome, nadp, steroid metabolism
Deposited on 2004-11-25, released 2004-12-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BEL
    • Uniprot P28845 (22-End)
    Domains in SCOPe 2.01: d2bela_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2belb_
  • Chain 'C':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BEL
    • Uniprot P28845 (22-End)
    Domains in SCOPe 2.01: d2belc_
  • Chain 'D':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BEL
    • Uniprot P28845 (22-End)
    Domains in SCOPe 2.01: d2beld_
  • Heterogens: NAP, CBO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2belA (A:)
    gsshhhhhhssgrenlyfqghmefrpemlqgkkvivtgaskgigremayhlakmgahvvv
    tarsketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitn
    tslnlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaay
    saskfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecal
    eiikggalrqeevyydsslwttllirnpcrkileflystsygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2belA (A:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    lli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2belB (B:)
    gsshhhhhhssgrenlyfqghmefrpemlqgkkvivtgaskgigremayhlakmgahvvv
    tarsketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitn
    tslnlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaay
    saskfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecal
    eiikggalrqeevyydsslwttllirnpcrkileflystsygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2belB (B:)
    frpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaasa
    hyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfls
    yvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsrv
    nvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwttl
    lirnpcrkile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2belC (C:)
    gsshhhhhhssgrenlyfqghmefrpemlqgkkvivtgaskgigremayhlakmgahvvv
    tarsketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitn
    tslnlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaay
    saskfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecal
    eiikggalrqeevyydsslwttllirnpcrkileflystsygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2belC (C:)
    grenlyfqghmefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkv
    vshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddih
    hvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgff
    ssirkeysvsrvnvsitlcvlglidtetamkavsgmqaapkeecaleiikggalrqeevy
    ydsslwttllirnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2belD (D:)
    gsshhhhhhssgrenlyfqghmefrpemlqgkkvivtgaskgigremayhlakmgahvvv
    tarsketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitn
    tslnlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaay
    saskfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecal
    eiikggalrqeevyydsslwttllirnpcrkileflystsygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2belD (D:)
    mefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
    sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
    lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
    rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwt
    tllirnpcrkile