PDB entry 2bef

View 2bef on RCSB PDB site
Description: crystal structure of ndp kinase complexed with mg, ADP, and bef3
Class: phosphotransferase
Keywords: phosphotransferase, nucleoside diphosphate kinase, phosphoryl transfer, beryllium fluoride
Deposited on 1998-05-26, released 1998-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2befa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2befb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2befc_
  • Heterogens: MG, BEF, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2befA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2befA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2befB (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2befB (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2befC (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2befC (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye