PDB entry 2be9

View 2be9 on RCSB PDB site
Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius
Class: Transferase
Keywords: ATCASE, HYPERTHERMOPHILIC, TEMPERATURE, TRANSFERASE,ALLOSTERIC, HOLOENZYME, CTP COMPLEX, Transferase
Deposited on 2005-10-23, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55338 (0-299)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d2be9a1, d2be9a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2be9b1, d2be9b2
  • Heterogens: ZN, SO4, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2be9A (A:)
    mlkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqka
    iinlggdvigfsgeestsvakgenladtirmlnnysdgivmrhkydgasrfaseisdipv
    inagdgkhehptqavidiytinkhfntidglvfallgdlkyartvnsllriltrfrpklv
    ylispqllrarkeildelnypvkevenpfevinevdvlyvtriqkerfvdemeyekikgs
    yivsldlankmkkdsiilhplprvneidrkvdkttkakyfeqasygvpvrmsiltkiyge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be9A (A:)
    mlkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqka
    iinlggdvigfsgegenladtirmlnnysdgivmrhkydgasrfaseisdipvinagdgk
    hehptqavidiytinkhfntidglvfallgdlkyartvnsllriltrfrpklvylispql
    lrarkeildelnypvkevenpfevinevdvlyvtriqkerfvdemeyekikgsyivsldl
    ankmkkdsiilhplprvneidrkvdkttkakyfeqasygvpvrmsiltkiyge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2be9B (B:)
    mefmmeiqgnrkelmvskikngtvidhipagrafavlnvlgikghegfrialvinvdskk
    mgkkdivkiedkeisdteanlitliaptatinivreyevvkktklevpkvvkgilkcpnp
    ycitsndveaiptfktltekplkmrceycetiideneimsqilgannk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be9B (B:)
    mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
    teanlitliaptatinivreyevvkktklevpkvvkgilkcpnpycitsndveaiptfkt
    ltekplkmrceycetiideneimsqilg