PDB entry 2be7

View 2be7 on RCSB PDB site
Description: Crystal structure of the unliganded (T-state) aspartate transcarbamoylase of the psychrophilic bacterium Moritella profunda
Class: Transferase
Keywords: atcase, psychrophilic, cold adaptation, transferase, allosteric, holoenzyme
Deposited on 2005-10-23, released 2006-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Moritella profunda [TaxId:111291]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2be7a1, d2be7a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Moritella profunda [TaxId:111291]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2be7b1, d2be7b2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Moritella profunda [TaxId:111291]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2be7c1, d2be7c2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Moritella profunda [TaxId:111291]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2be7d1, d2be7d2
  • Chain 'E':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Moritella profunda [TaxId:111291]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2be7e1, d2be7e2
  • Chain 'F':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Moritella profunda [TaxId:111291]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2be7f1, d2be7f2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2be7A (A:)
    mgsshhhhhhsqdpnsmanplfrkhivsindisrnelelivktaaklkeqpqpellknkv
    iascffeastrtrlsfetaiqrlggsvigfdnagntslakkgetladsisvissyadafv
    mrhpqegaarlasefsnvpvinggdgsnqhptqtlldlfsiyetqgrldnlniafvgdlk
    ygrtvhslaqalakfdgckfhfiapdalampeyicdeldeqnisyatyasieevvpeidv
    lymtrvqkerfdeteyqhmkagfilsasslvhakpnlkvlhplprvdeiatdvdktpyay
    yfqqaengvyareallalvlnetige
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be7A (A:)
    anplfrkhivsindisrnelelivktaaklkeqpqpellknkviascffeastrtrlsfe
    taiqrlggsvigfdnagntslakkgetladsisvissyadafvmrhpqegaarlasefsn
    vpvinggdgsnqhptqtlldlfsiyetqgrldnlniafvgdlkygrtvhslaqalakfdg
    ckfhfiapdalampeyicdeldeqnisyatyasieevvpeidvlymtrvqkerfdeteyq
    hmkagfilsasslvhakpnlkvlhplprvdeiatdvdktpyayyfqqaengvyarealla
    lvlnetige
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2be7B (B:)
    mgsshhhhhhsqdpnsmanplfrkhivsindisrnelelivktaaklkeqpqpellknkv
    iascffeastrtrlsfetaiqrlggsvigfdnagntslakkgetladsisvissyadafv
    mrhpqegaarlasefsnvpvinggdgsnqhptqtlldlfsiyetqgrldnlniafvgdlk
    ygrtvhslaqalakfdgckfhfiapdalampeyicdeldeqnisyatyasieevvpeidv
    lymtrvqkerfdeteyqhmkagfilsasslvhakpnlkvlhplprvdeiatdvdktpyay
    yfqqaengvyareallalvlnetige
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be7B (B:)
    anplfrkhivsindisrnelelivktaaklkeqpqpellknkviascffeastrtrlsfe
    taiqrlggsvigfdnagntslakkgetladsisvissyadafvmrhpqegaarlasefsn
    vpvinggdgsnqhptqtlldlfsiyetqgrldnlniafvgdlkygrtvhslaqalakfdg
    ckfhfiapdalampeyicdeldeqnisyatyasieevvpeidvlymtrvqkerfdeteyq
    hmkagfilsasslvhakpnlkvlhplprvdeiatdvdktpyayyfqqaengvyarealla
    lvlnetige
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2be7C (C:)
    mgsshhhhhhsqdpnsmanplfrkhivsindisrnelelivktaaklkeqpqpellknkv
    iascffeastrtrlsfetaiqrlggsvigfdnagntslakkgetladsisvissyadafv
    mrhpqegaarlasefsnvpvinggdgsnqhptqtlldlfsiyetqgrldnlniafvgdlk
    ygrtvhslaqalakfdgckfhfiapdalampeyicdeldeqnisyatyasieevvpeidv
    lymtrvqkerfdeteyqhmkagfilsasslvhakpnlkvlhplprvdeiatdvdktpyay
    yfqqaengvyareallalvlnetige
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be7C (C:)
    anplfrkhivsindisrnelelivktaaklkeqpqpellknkviascffeastrtrlsfe
    taiqrlggsvigfdnagntslakkgetladsisvissyadafvmrhpqegaarlasefsn
    vpvinggdgsnqhptqtlldlfsiyetqgrldnlniafvgdlkygrtvhslaqalakfdg
    ckfhfiapdalampeyicdeldeqnisyatyasieevvpeidvlymtrvqkerfdeteyq
    hmkagfilsasslvhakpnlkvlhplprvdeiatdvdktpyayyfqqaengvyarealla
    lvlnetige
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2be7D (D:)
    mknnhmqveaicngyvidhipsgqgvkilklfsltdtkqrvtvgfnlptkdgnakdlikv
    enteitksqanqlallapnatiniienfkvtdkhsltlpnevenvfpcpnsncithgepv
    tssfsikktkgniglkckycektfskdivteqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be7D (D:)
    cngyvidhipsgqgvkilklfsltdtkqrvtvgfnlkdlikventeitksqanqlallap
    natiniienfkvtdkhsltlpnevenvfpcpnsncithgepvtssfsikktkgniglkck
    ycektfskdivte
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2be7E (E:)
    mknnhmqveaicngyvidhipsgqgvkilklfsltdtkqrvtvgfnlptkdgnakdlikv
    enteitksqanqlallapnatiniienfkvtdkhsltlpnevenvfpcpnsncithgepv
    tssfsikktkgniglkckycektfskdivteqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be7E (E:)
    cngyvidhipsgqgvkilklfsltdtkqrvtvgfnlpkdlikventeitksqanqlalla
    pnatiniienfkvtdkhsltlpnevenvfpcpnsncithgepvtssfsikniglkckyce
    ktfskdivte
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2be7F (F:)
    mknnhmqveaicngyvidhipsgqgvkilklfsltdtkqrvtvgfnlptkdgnakdlikv
    enteitksqanqlallapnatiniienfkvtdkhsltlpnevenvfpcpnsncithgepv
    tssfsikktkgniglkckycektfskdivteqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2be7F (F:)
    yvidhipsgqgvkilklfsltdtkqrvtvgfnlkdlikventeitksqanqlallapnat
    iniienfkvtdkhsltlpnevenvfpcpnsncithgepvtssfsikniglkckycektfs
    kdivt