PDB entry 2bdy

View 2bdy on RCSB PDB site
Description: thrombin in complex with inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin, complex structure, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-10-21, released 2006-10-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bdya_
  • Chain 'B':
    Compound: Hirudin IIIB'
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, UNB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bdyA (A:)
    adcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcga
    slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
    nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
    nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
    mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdyA (A:)
    adcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgasli
    sdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwr
    enldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketgqpsvl
    qvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwy
    qmgivswgegcdrdgkygfythvfrlkkwiqkvidq
    

  • Chain 'B':
    No sequence available.