PDB entry 2bdr

View 2bdr on RCSB PDB site
Description: Crystal Structure of the Putative Ureidoglycolate hydrolase PP4288 from Pseudomonas putida, Northeast Structural Genomics Target PpR49
Class: hydrolase
Keywords: all beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2005-10-20, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycolate hydrolase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59285 (0-End)
      • modified residue (0)
      • modified residue (4)
      • modified residue (29)
      • modified residue (36)
      • modified residue (65)
      • modified residue (71)
      • modified residue (159)
    Domains in SCOPe 2.08: d2bdra1
  • Chain 'B':
    Compound: Ureidoglycolate hydrolase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59285 (0-End)
      • modified residue (0)
      • modified residue (4)
      • modified residue (29)
      • modified residue (36)
      • modified residue (65)
      • modified residue (71)
      • modified residue (159)
    Domains in SCOPe 2.08: d2bdrb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bdrA (A:)
    mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr
    adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny
    hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnphqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdrA (A:)
    mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr
    adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny
    hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bdrB (B:)
    mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr
    adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny
    hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnphqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdrB (B:)
    mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr
    adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny
    hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnph