PDB entry 2bdm

View 2bdm on RCSB PDB site
Description: Structure of Cytochrome P450 2B4 with Bound Bifonazole
Class: oxidoreductase
Keywords: p450, Monooxygenase, Oxidoreductase, membrane protein, CYP 2B4, CYP LM2
Deposited on 2005-10-20, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B4
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CYP2B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00178 (Start-471)
      • engineered (9)
      • see remark 999 (201)
      • engineered (206)
      • expression tag (472)
    Domains in SCOPe 2.08: d2bdma2, d2bdma3
  • Heterogens: HEM, TMI, CM5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bdmA (A:)
    makktsskgklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlc
    gtdairealvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgk
    rsveeriqeearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrll
    dlffqsfslissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldps
    nprdfidvyllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyph
    vtervqkeieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrg
    yvipkntevfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclge
    giartelflffttilqnfsiaspvppedidltpresgvgnvppsyqirflarhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdmA (A:)
    gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
    lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
    eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
    lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
    yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
    ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
    vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
    lffttilqnfsiaspvppedidltpresgvgnvppsyqirflarh