PDB entry 2bdf

View 2bdf on RCSB PDB site
Description: Src kinase in complex with inhibitor AP23451
Class: transferase
Keywords: Src Kinase Inhibitor, TRANSFERASE
Deposited on 2005-10-20, released 2006-10-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bdfa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bdfb_
  • Heterogens: 24A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bdfA (A:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
    kklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgm
    ayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaa
    lygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdl
    mcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdfA (A:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvadfglarliefpikwtapeaalygrftiksdvws
    fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp
    tfeylqafledyftstepqyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bdfB (B:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
    kklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgm
    ayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaa
    lygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdl
    mcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bdfB (B:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
    kklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgm
    ayvermnyvhrdlraanilvgenlvckvadfglarlieakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
    eerptfeylqafledyftstepqyq