PDB entry 2bda

View 2bda on RCSB PDB site
Description: Porcine pancreatic elastase complexed with N-acetyl-NPI and Ala-Ala at pH 5.0
Class: hydrolase
Keywords: SERINE PROTEINASE, hydrolase
Deposited on 2005-10-20, released 2006-05-30
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-22, with a file datestamp of 2008-07-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • see remark 999 (65)
    Domains in SCOP 1.75: d2bdaa1
  • Chain 'P':
    Compound: npi
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2BDA (Start-2)
  • Heterogens: CA, SO4, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bdaA (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'P':
    No sequence available.