PDB entry 2bd4

View 2bd4 on RCSB PDB site
Description: Porcine pancreatic elastase complexed with beta-casomorphin-7 and Lys-Ser at pH 5.0
Class: hydrolase
Keywords: SERINE PROTEINASE, hydrolase
Deposited on 2005-10-20, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • see remark 999 (65)
    Domains in SCOPe 2.08: d2bd4a_
  • Chain 'P':
    Compound: beta-casomorphin-7
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2BD4 (Start-6)
  • Heterogens: LYS, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bd4A (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'P':
    No sequence available.