PDB entry 2bd2

View 2bd2 on RCSB PDB site
Description: Porcine pancreatic elastase complexed with beta-casomorphin-7 and Arg-Phe at pH 5.0
Class: hydrolase
Keywords: serine proteinase
Deposited on 2005-10-20, released 2006-05-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • see remark 999 (65)
    Domains in SCOP 1.73: d2bd2a1
  • Chain 'P':
    Compound: beta-casomorphin-7
    Species: synthetic, synthetic
  • Heterogens: CA, SO4, ARG, PHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bd2A (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'P':
    No sequence available.