PDB entry 2bd1

View 2bd1 on RCSB PDB site
Description: A possible role of the second calcium ion in interfacial binding: Atomic and medium resolution crystal structures of the quadruple mutant of phospholipase A2
Class: hydrolase
Keywords: alpha helix, beta sheet, HYDROLASE
Deposited on 2005-10-19, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (52)
      • engineered (55)
      • engineered (119-120)
    Domains in SCOPe 2.07: d2bd1a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (52)
      • engineered (55)
      • engineered (119-120)
    Domains in SCOPe 2.07: d2bd1b_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bd1A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
    mnc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bd1B (B:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
    mnc