PDB entry 2bd0

View 2bd0 on RCSB PDB site
Description: Chlorobium tepidum Sepiapterin Reductase complexed with NADP and Sepiapterin
Class: oxidoreductase
Keywords: sepiapterin reductase, Chlorobium tepidum, OXIDOREDUCTASE
Deposited on 2005-10-19, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Chlorobaculum tepidum [TaxId:194439]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bd0a1
  • Chain 'B':
    Compound: sepiapterin reductase
    Species: Chlorobaculum tepidum [TaxId:194439]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bd0b_
  • Chain 'C':
    Compound: sepiapterin reductase
    Species: Chlorobaculum tepidum [TaxId:194439]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bd0c_
  • Chain 'D':
    Compound: sepiapterin reductase
    Species: Chlorobaculum tepidum [TaxId:194439]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bd0d_
  • Heterogens: NAP, BIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bd0A (A:)
    mkhillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegalt
    dtitadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkg
    tffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcn
    vritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgd
    iqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bd0A (A:)
    khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
    titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
    ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
    ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bd0B (B:)
    mkhillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegalt
    dtitadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkg
    tffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcn
    vritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgd
    iqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bd0B (B:)
    khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
    titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
    ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
    ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bd0C (C:)
    mkhillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegalt
    dtitadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkg
    tffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcn
    vritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgd
    iqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bd0C (C:)
    khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
    titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
    ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
    ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bd0D (D:)
    mkhillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegalt
    dtitadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkg
    tffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcn
    vritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgd
    iqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bd0D (D:)
    khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
    titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
    ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
    ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi