PDB entry 2bcg

View 2bcg on RCSB PDB site
Description: Structure of doubly prenylated Ypt1:GDI complex
Class: Protein Transport
Keywords: RabGTPase, geranylgeranylation, vesicular transport, Protein Transport
Deposited on 2005-10-19, released 2006-01-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.165
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Secretory pathway GDP dissociation inhibitor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GDI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bcgg1, d2bcgg2, d2bcgg3
  • Chain 'Y':
    Compound: GTP-binding protein YPT1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YPT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bcgy_
  • Heterogens: MG, GDP, GER, TRS, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bcgG (G:)
    ghmdqetidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlye
    kfkqnpiskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyv
    fkqgkiykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmde
    vyykfglgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyg
    lgelpqgfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfp
    ekckstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskg
    hylaiistiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydas
    shfesmtddvkdiyfrvtghplvlkqrqeqekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bcgG (G:)
    tidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnp
    iskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgki
    ykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfg
    lgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpq
    gfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekckst
    gqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghylaii
    stiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydasshfesm
    tddvkdiyfrvtghplvlkqrq
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2bcgY (Y:)
    mnseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklq
    iwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvg
    nkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlne
    ttqkkedkgnvnlkgqsltntggccc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bcgY (Y:)
    seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
    dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
    cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
    qkkedkgnvnlkgq