PDB entry 2bcc

View 2bcc on RCSB PDB site
Description: stigmatellin-bound cytochrome bc1 complex from chicken
Class: oxidoreductase
Keywords: ubiquinone, oxidoreductase, redox enzyme, membrane protein, respiratory chain, stigmatellin
Deposited on 1998-09-18, released 1999-08-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.284
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC
    Domains in SCOPe 2.05: d2bcca1, d2bcca2
  • Chain 'B':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (0-421)
    Domains in SCOPe 2.05: d2bccb1, d2bccb2
  • Chain 'C':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bccc2, d2bccc3
  • Chain 'D':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (0-240)
    Domains in SCOPe 2.05: d2bccd2, d2bccd3
  • Chain 'E':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (0-195)
    Domains in SCOPe 2.05: d2bcce1, d2bcce2
  • Chain 'F':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (Start-108)
    Domains in SCOPe 2.05: d2bccf_
  • Chain 'G':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC
    Domains in SCOPe 2.05: d2bccg_
  • Chain 'H':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (Start-77)
    Domains in SCOPe 2.05: d2bcch_
  • Chain 'I':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (0-32)
  • Chain 'J':
    Compound: ubiquinol cytochrome c oxidoreductase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BCC (Start-61)
    Domains in SCOPe 2.05: d2bccj_
  • Heterogens: BOG, HEM, FES, U10, PEE, SIG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bccA (A:)
    tayyaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyfle
    hlafkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqnc
    sledsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsra
    dlteylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsq
    irhredglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavt
    nklcqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknf
    lrnalvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcp
    avagpgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccA (A:)
    yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
    fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
    dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
    eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsqirh
    redglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavtnkl
    cqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknflrn
    alvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcpava
    gpgpieqlpdynrirsgmfwlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrglnatsslyqavakgvhqpfdvsafnasys
    dsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvesseg
    fleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvd
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrgnpfdvsafnasysdsglfgfytisqaaya
    gqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvessegfleevgsqalaagsyn
    ppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvdel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bccC (C:)
    mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
    slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
    lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
    alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
    ltlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvl
    ilflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyf
    tillilfptigtlenkmlny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccC (C:)
    apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
    lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
    ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
    lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
    tlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvli
    lflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyft
    illilfptigtlenkmlny
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccD (D:)
    sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bccE (E:)
    shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bccF (F:)
    agrpavsassrwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmf
    rikraldlnmrqqilpkeqwtkyeedvpylepylkevirerkereewdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccF (F:)
    srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
    mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bccG (G:)
    grqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllyt
    wgtqefekskrknpaayvndr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccG (G:)
    rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
    gtqefekskrknpaayvn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bccH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfd
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
    lfnslk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bccJ (J:)
    vaptltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bccJ (J:)
    tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk