PDB entry 2bcb

View 2bcb on RCSB PDB site
Description: high-resolution solution structure of calcium-loaded calbindin d9k
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-08-18, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calbindin d9k
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (0-74)
    • conflict (42)
  Domains in SCOPe 2.06: d2bcba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bcbA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq