PDB entry 2bcb

View 2bcb on RCSB PDB site
Description: high-resolution solution structure of calcium-loaded calbindin d9k
Deposited on 1993-08-18, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d2bcb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bcb_ (-)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq