PDB entry 2bc5

View 2bc5 on RCSB PDB site
Description: Crystal structure of E. coli cytochrome b562 with engineered c-type heme linkages
Class: electron transport
Keywords: Four-Helix Bundle, K59W, R98C and Y101C mutations, ELECTRON TRANSPORT
Deposited on 2005-10-18, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.239
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d2bc5a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d2bc5b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d2bc5c_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d2bc5d_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bc5A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bc5B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bc5C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bc5D (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr