PDB entry 2bc3

View 2bc3 on RCSB PDB site
Description: T7-tagged full-length streptavidin
Class: biotin binding protein
Keywords: streptavidin, T7 tag, BIOTIN BINDING PROTEIN
Deposited on 2005-10-18, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.179
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-158)
      • t7-tag (12)
    Domains in SCOPe 2.07: d2bc3a2, d2bc3a3
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bc3b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bc3A (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc3A (A:)
    deagitgtwynqlgstfivtagadgaltgtyesgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    psaasidaakkagvnngnpldavqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bc3B (B:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc3B (B:)
    eagitgtwynqlgstfivtagadgaltgtyesanaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    saasidaakkagvnngnplda