PDB entry 2bc2

View 2bc2 on RCSB PDB site
Description: metallo beta-lactamase ii from bacillus cereus 569/h/9 at ph 6.0, trigonal crystal form
Deposited on 1997-09-09, released 1999-04-20
The last revision prior to the SCOP 1.59 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d2bc2a_
  • Chain 'B':
    Domains in SCOP 1.59: d2bc2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bc2A (A:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc2A (A:)
    tviknetgtisisqlnknvwvhtelgseavpsnglvlntskglvlvdsswddkltkelie
    mvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqt
    vtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvnew
    stsienvlkryrninavvpghgevgdkglllhtldllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bc2B (B:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bc2B (B:)
    tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
    ekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvt
    nlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvnewst
    sienvlkryrninavvpghgevgdkglllhtldllk