PDB entry 2bby

View 2bby on RCSB PDB site
Description: dna-binding domain from human rap30, nmr, 30 structures
Deposited on 1998-04-27, released 1998-11-25
The last revision prior to the SCOP 1.69 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d2bby__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bby_ (-)
    raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
    lkpeyrhyq