PDB entry 2bbw

View 2bbw on RCSB PDB site
Description: Crystal structure of human adenylate kinase 4 (AK4) in complex with diguanosine pentaphosphate
Class: transferase
Keywords: AK4, nucleotide kinase, nucleotide binding, human, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2005-10-17, released 2005-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase 4, AK4
    Species: Homo sapiens [TaxId:9606]
    Gene: AK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bbwa1, d2bbwa2
  • Chain 'B':
    Compound: adenylate kinase 4, AK4
    Species: Homo sapiens [TaxId:9606]
    Gene: AK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bbwb1, d2bbwb2
  • Heterogens: GP5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bbwA (A:)
    mhhhhhhssgvdlgtenlyfqsmaskllravilgppgsgkgtvcqriaqnfglqhlssgh
    flrenikastevgemakqyieksllvpdhvitrlmmselenrrgqhwlldgfprtlgqae
    aldkicevdlvislnipfetlkdrlsrrwihppsgrvynldfnpphvhgiddvtgeplvq
    qeddkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
    skeayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bbwA (A:)
    kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
    vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
    srrwihppsgrvynldfnpphvhgiddvtgeplvqqeddkpeavaarlrqykdvakpvie
    lyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bbwB (B:)
    mhhhhhhssgvdlgtenlyfqsmaskllravilgppgsgkgtvcqriaqnfglqhlssgh
    flrenikastevgemakqyieksllvpdhvitrlmmselenrrgqhwlldgfprtlgqae
    aldkicevdlvislnipfetlkdrlsrrwihppsgrvynldfnpphvhgiddvtgeplvq
    qeddkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
    skeayl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bbwB (B:)
    kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
    vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
    srrwihppsgrvynldfnpphvhgiddvtgeplvqqeddkpeavaarlrqykdvakpvie
    lyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeay