PDB entry 2bbv

View 2bbv on RCSB PDB site
Description: the refined three-dimensional structure of an insect virus at 2.8 angstroms resolution
Deposited on 1994-06-06, released 1994-08-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d2bbva_
  • Chain 'B':
    Domains in SCOP 1.65: d2bbvb_
  • Chain 'C':
    Domains in SCOP 1.65: d2bbvc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bbvA (A:)
    mvrnnnrrrqrtqrivttttqtapvpqqnvpkqprrrrnrarrnrrqgramnmgaltrls
    qpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqsinftanrdtfiliaptpg
    vaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdqvssfryasmnvgiyptsn
    lmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldgvlavgpdnfsesfikgvf
    sqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaagaeavsgivgwgnmdtivir
    vsaptgavnsailktwacleyrpnpnamlyqfghdsppcdevalqeyrtvarslpvavia
    aqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bbvA (A:)
    ltrlsqpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqsinftanrdtfili
    aptpgvaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdqvssfryasmnvgi
    yptsnlmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldgvlavgpdnfsesf
    ikgvfsqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaagaeavsgivgwgnmd
    tivirvsaptgavnsailktwacleyrpnpnamlyqfghdsppcdevalqeyrtvarslp
    vaviaaqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bbvB (B:)
    mvrnnnrrrqrtqrivttttqtapvpqqnvpkqprrrrnrarrnrrqgramnmgaltrls
    qpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqsinftanrdtfiliaptpg
    vaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdqvssfryasmnvgiyptsn
    lmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldgvlavgpdnfsesfikgvf
    sqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaagaeavsgivgwgnmdtivir
    vsaptgavnsailktwacleyrpnpnamlyqfghdsppcdevalqeyrtvarslpvavia
    aqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bbvB (B:)
    ltrlsqpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqsinftanrdtfili
    aptpgvaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdqvssfryasmnvgi
    yptsnlmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldgvlavgpdnfsesf
    ikgvfsqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaagaeavsgivgwgnmd
    tivirvsaptgavnsailktwacleyrpnpnamlyqfghdsppcdevalqeyrtvarslp
    vaviaaqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bbvC (C:)
    mvrnnnrrrqrtqrivttttqtapvpqqnvpkqprrrrnrarrnrrqgramnmgaltrls
    qpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqsinftanrdtfiliaptpg
    vaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdqvssfryasmnvgiyptsn
    lmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldgvlavgpdnfsesfikgvf
    sqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaagaeavsgivgwgnmdtivir
    vsaptgavnsailktwacleyrpnpnamlyqfghdsppcdevalqeyrtvarslpvavia
    aqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bbvC (C:)
    tqtapvpqqnvpaltrlsqpglaflkcafappdfntdpgkgipdrfegkvvtrkdvlnqs
    inftanrdtfiliaptpgvaywvadvpagtfpistttfnavnfpgfnsmfgnaaasrsdq
    vssfryasmnvgiyptsnlmqfagsitvwkcpvklsnvqfpvattpatsalvhtlvgldg
    vlavgpdnfsesfikgvfsqsvcnepdfefsdilegiqtlppanvtvatsgqpfnlaaga
    eavsgivgwgnmdtivirvsaptgavnsailktwacleyrpnpnamlyqfghdsppcdev
    alqeyrtvarslpvaviaaqn