PDB entry 2bbn

View 2bbn on RCSB PDB site
Description: solution structure of a calmodulin-target peptide complex by multidimensional nmr
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1992-07-16, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Drosophila melanogaster
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62152 (0-147)
  Domains in SCOP 1.75: d2bbna_
• Chain 'B':
  Compound: myosin light chain kinase
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07313 (0-25)
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bbnA (A:)
  adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
  gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
  vdemireadidgdgqvnyeefvtmmtsk
  

  
  
• Chain 'B':
  No sequence available.