PDB entry 2bbk

View 2bbk on RCSB PDB site
Description: crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Deposited on 1993-12-17, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d2bbkh_
  • Chain 'J':
    Domains in SCOP 1.55: d2bbkj_
  • Chain 'L':
    Domains in SCOP 1.55: d2bbkl_
  • Chain 'M':
    Domains in SCOP 1.55: d2bbkm_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkH (H:)
    deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
    iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
    lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
    peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
    eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
    eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkJ (J:)
    deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
    iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
    lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
    peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
    eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
    eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkL (L:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbkM (M:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas