PDB entry 2bbi

View 2bbi on RCSB PDB site
Description: three-dimensional structure of soybean trypsin(slash)chymotrypsin bowman-birk inhibitor in solution
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1991-09-19, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin/chymotrypsin bowman-birk inhibitor
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bbia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bbiA (A:)
    ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
    pckpseddken