PDB entry 2bbi

View 2bbi on RCSB PDB site
Description: three-dimensional structure of soybean trypsin(slash)chymotrypsin bowman-birk inhibitor in solution
Deposited on 1991-09-19, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2bbi__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bbi_ (-)
  ddesskpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcye
  pckpseddken