PDB entry 2bbf

View 2bbf on RCSB PDB site
Description: Crystal structure of tRNA-guanine transglycosylase (TGT) from Zymomonas mobilis in complex with 6-amino-3,7-dihydro-imidazo[4,5-g]quinazolin-8-one
Class: transferase
Keywords: protein-ligand complex, TRANSFERASE
Deposited on 2005-10-17, released 2007-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA guanine transglycosylase
    Species: Zymomonas mobilis [TaxId:542]
    Gene: tgt
    Database cross-references and differences (RAF-indexed):
    • GB AAG29862
    Domains in SCOPe 2.06: d2bbfa_
  • Heterogens: ZN, 344, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bbfA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bbfA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmsltkqseegvtfkshlsrhml
    spersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaen
    aalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddk
    phylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpld
    sechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaq
    dfraryf