PDB entry 2bb8

View 2bb8 on RCSB PDB site
Description: n-terminal DNA binding domain from tn916 integrase, nmr, minimized average structure
Class: DNA recombination
Keywords: DNA recombination, integrase, DNA binding, transposition, transposase
Deposited on 1998-05-12, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: integrase
  Species: Enterococcus faecalis [TaxId:1351]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22886 (0-70)
  Domains in SCOPe 2.07: d2bb8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bb8A (A:)
  ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
  kiaelqkdihd