PDB entry 2bb8

View 2bb8 on RCSB PDB site
Description: n-terminal DNA binding domain from tn916 integrase, nmr, minimized average structure
Class: DNA recombination
Keywords: DNA recombination, integrase, DNA binding, transposition, transposase
Deposited on 1998-05-12, released 1998-11-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bb8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bb8A (A:)
    ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
    kiaelqkdihd