PDB entry 2bb8

View 2bb8 on RCSB PDB site
Description: n-terminal dna binding domain from tn916 integrase, nmr, minimized average structure
Deposited on 1998-05-12, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2bb8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bb8_ (-)
    ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislre
    kiaelqkdihd