PDB entry 2bb7

View 2bb7 on RCSB PDB site
Description: Mn Form Of E. coli Methionine Aminopeptidase In Complex With a quinolinyl sulfonamide inhibitor
Class: hydrolase
Keywords: trimetallic, Mn(II)-form, hydrolase, enzyme-inhibitor complex, metalloenzyme
Deposited on 2005-10-17, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bb7a_
  • Heterogens: MN, NA, QMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bb7A (A:)
    maisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsacl
    gyhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkpti
    mgerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfhee
    pqvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivv
    tdngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bb7A (A:)
    iktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyhg
    ypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimger
    lcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqvl
    hydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdng
    ceiltlrkddtipaiish