PDB entry 2bb4

View 2bb4 on RCSB PDB site
Description: Porcine pancreatic elastase complexed with beta-casomorphin-7 and Asp-Phe at pH 5.0
Class: hydrolase
Keywords: SERINE PROTEINASE, hydrolase
Deposited on 2005-10-17, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • see remark 999 (65)
    Domains in SCOPe 2.08: d2bb4a_
  • Chain 'P':
    Compound: beta-casomorphin-7
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2BB4 (Start-6)
  • Heterogens: ASP, CA, SO4, PHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bb4A (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'P':
    No sequence available.