PDB entry 2bb3

View 2bb3 on RCSB PDB site
Description: Crystal Structure of Cobalamin Biosynthesis Precorrin-6Y Methylase (cbiE) from Archaeoglobus fulgidus
Class: transferase
Keywords: beta, alpha-beta-alpha sandwich, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-10-17, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cobalamin biosynthesis precorrin-6Y methylase (cbiE)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29536 (22-End)
      • cloning artifact (19-21)
      • modified residue (22)
      • modified residue (82)
      • modified residue (99)
      • modified residue (188)
    Domains in SCOPe 2.07: d2bb3a1, d2bb3a2
  • Chain 'B':
    Compound: cobalamin biosynthesis precorrin-6Y methylase (cbiE)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29536 (22-End)
      • cloning artifact (20-21)
      • modified residue (22)
      • modified residue (82)
      • modified residue (99)
      • modified residue (188)
    Domains in SCOPe 2.07: d2bb3b2, d2bb3b3
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bb3A (A:)
    mgsshhhhhhssgrenlyfsghmiwivgsgtcrgqtterakeiieraeviygsrralela
    gvvddsrarilrsfkgdeirrimeegrerevavistgdpmvaglgrvlreiaedveikie
    paissvqvalarlkvdlsevavvdchakdfdaeltellkyrhlliladshfplerlgkrr
    vvllenlcmegeriregnadsielesdytiifverevmegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bb3A (A:)
    sghmiwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdei
    rrimeegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlse
    vavvdcfdaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsie
    lesdytiifverev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bb3B (B:)
    mgsshhhhhhssgrenlyfsghmiwivgsgtcrgqtterakeiieraeviygsrralela
    gvvddsrarilrsfkgdeirrimeegrerevavistgdpmvaglgrvlreiaedveikie
    paissvqvalarlkvdlsevavvdchakdfdaeltellkyrhlliladshfplerlgkrr
    vvllenlcmegeriregnadsielesdytiifverevmegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bb3B (B:)
    ghmiwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeir
    rimeegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsev
    avvdchaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsiele
    sdytiifverev