PDB entry 2baz

View 2baz on RCSB PDB site
Description: Structure of YosS, a putative dUTPase from Bacillus subtilis
Class: unknown function
Keywords: homotrimer, beta barrel, UNKNOWN FUNCTION
Deposited on 2005-10-16, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU20020
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2baza_
  • Chain 'B':
    Compound: hypothetical protein BSU20020
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bazb_
  • Chain 'C':
    Compound: hypothetical protein BSU20020
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bazc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bazA (A:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bazA (A:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bazB (B:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bazB (B:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bazC (C:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bazC (C:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl