PDB entry 2bax

View 2bax on RCSB PDB site
Description: Atomic Resolution Structure of the Double Mutant (K53,56M) of Bovine Pancreatic Phospholipase A2
Class: hydrolase
Keywords: Phospholipase A2, alpha helix, beta sheet
Deposited on 2005-10-15, released 2005-10-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-04, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.114
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: BOS TAURUS
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (52)
    • engineered (55)
  Domains in SCOP 1.73: d2baxa1
• Heterogens: CA, CL, MRD, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2baxA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  knc