PDB entry 2bat

View 2bat on RCSB PDB site
Description: the structure of the complex between influenza virus neuraminidase and sialic acid, the viral receptor
Deposited on 1992-08-10, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2bat__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bat_ (-)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddrssnsncrnpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
    gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi