PDB entry 2bap

View 2bap on RCSB PDB site
Description: Crystal structure of the N-terminal mDia1 Armadillo Repeat Region and Dimerisation Domain in complex with the mDia1 autoregulatory domain (DAD)
Class: signaling protein
Keywords: Armadillo Repeats, all helical
Deposited on 2005-10-14, released 2006-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.292
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaphanous protein homolog 1
    Species: MUS MUSCULUS
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bapa1
  • Chain 'B':
    Compound: Diaphanous protein homolog 1
    Species: MUS MUSCULUS
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bapb1
  • Chain 'C':
    Compound: Diaphanous protein homolog 1
    Species: MUS MUSCULUS
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Diaphanous protein homolog 1
    Species: MUS MUSCULUS
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bapA (A:)
    sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeke
    etsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakll
    salcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalit
    paeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddi
    rmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivl
    hkngtdpdfkcrhlqid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bapA (A:)
    sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeky
    dsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcil
    pqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeld
    frvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemdd
    fgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bapB (B:)
    sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdeke
    etsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakll
    salcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalit
    paeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddi
    rmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivl
    hkngtdpdfkcrhlqid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bapB (B:)
    sammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdekd
    srnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcilp
    qpedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeldf
    rvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddf
    gevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.